We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MB21D2 Antibody Blocking Peptide

Images

 

Product Details

Summary
Product Discontinued
View other related MB21D2 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-79527PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MB21D2 Antibody Blocking Peptide Summary

Description
A MB21D2 antibody blocking peptide corresponding to amino acids from the C-terminal region of human MB21D2 Accession #: NP_848591

Source: Synthetic

Amino Acid Sequence: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF

For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.

Source
Synthetic
Protein/Peptide Type
Antibody Blocking Peptide
Gene
MB21D2
Purity
N/A

Applications/Dilutions

Dilutions
  • Antibody Competition
  • Western Blot
Application Notes
This peptide is useful as a blocking peptide for NBP1-79527. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested.

For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized with sterile distilled water.
Preservative
No Preservative
Concentration
LYOPH
Purity
N/A
Reconstitution Instructions
Reconstitute with 100ul of sterile PBS for a final peptide concentration of 1 mg/ml.

Alternate Names for MB21D2 Antibody Blocking Peptide

  • C3orf59
  • chromosome 3 open reading frame 59
  • hypothetical protein LOC151963
  • Mab-21 domain containing 2
  • Mab-21 domain-containing protein 2

Background

This is a synthetic peptide designed for use in combination with anti-C3orf59. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for MB21D2 Protein (NBP1-79527PEP) (0)

There are no publications for MB21D2 Protein (NBP1-79527PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MB21D2 Protein (NBP1-79527PEP) (0)

There are no reviews for MB21D2 Protein (NBP1-79527PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MB21D2 Protein (NBP1-79527PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MB21D2 Products

Blogs on MB21D2

There are no specific blogs for MB21D2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MB21D2 Antibody Blocking Peptide and receive a gift card or discount.

Bioinformatics

Gene Symbol MB21D2