MB21D2 Antibody Blocking Peptide

Product Discontinued

MB21D2 Antibody Blocking Peptide Summary

• Description: A MB21D2 antibody blocking peptide corresponding to amino acids from the C-terminal region of human MB21D2 Accession #: NP_848591

  Source: Synthetic

  Amino Acid Sequence: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF
  
  For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.

• Source: Synthetic
• Protein/Peptide Type: Antibody Blocking Peptide
• Gene: MB21D2
• Purity: N/A

Applications/Dilutions

• Dilutions:
  • Antibody Competition
  • Western Blot
• Application Notes: This peptide is useful as a blocking peptide for NBP1-79527. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested.
  
  For further blocking peptide related protocol, click here.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized with sterile distilled water.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: N/A
• Reconstitution Instructions: Reconstitute with 100ul of sterile PBS for a final peptide concentration of 1 mg/ml.

Alternate Names for MB21D2 Antibody Blocking Peptide

• C3orf59
• chromosome 3 open reading frame 59
• hypothetical protein LOC151963
• Mab-21 domain containing 2
• Mab-21 domain-containing protein 2

Background

This is a synthetic peptide designed for use in combination with anti-C3orf59. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MB21D2