Recombinant Human LOC283155 similar to ALK-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LOC283155 similar to ALK-3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 207 - 297 of Human LOC283155 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKMLAKMVESQDVKI

Protein/Peptide Type
Partial Recombinant Protein
Gene
LOC283155

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Hepes-NaOH, 100 mM NaCl, pH 7.5, 5 mM DTT, 4 mM reduced glutathione, 20% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Background

LOC283155 - similar to bone morphogenetic protein receptor, type IA precursor; activin A receptor, type II-like kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01) (0)

There are no publications for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01) (0)

There are no reviews for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LOC283155 similar to ALK-3 Products

LOC283155 similar to ALK-3 H00283155-Q01

Bioinformatics Tool for LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01)

Discover related pathways, diseases and genes to LOC283155 similar to ALK-3 Partial Recombinant Protein (H00283155-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LOC283155 similar to ALK-3

There are no specific blogs for LOC283155 similar to ALK-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LOC283155 similar to ALK-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LOC283155