| Immunogen | The immunogen for this antibody is LOC100362123 - C-terminal region. Peptide sequence HSGEKPYKCSECDKYFSQQSNLSIHRRIHTGEKPYKCSECDKCFGYKGSL. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LOC100362123 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LOC100362123 |
| Uniprot |
|