lmn-1 Antibody

Product Discontinued

lmn-1 Antibody Summary

• Immunogen: In vivo generated recominant protein fragment
• Epitope: MSSRKGTRSSRIVTLERSANSSLSNNGGGDDSFGSTLLETSRLQEKDHLTSLNSRLATYIDKVRQLEQENNRLQVQIRDIEVVEKKEKSNLADRFEAEKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Western Blot 1:100-1:2000
• Application Notes: This product is useful in ELISA and Western Blot.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for lmn-1 Antibody

• LMN 1
• LMN1

Background

Major component of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane. Provides a framework for the nuclear envelope and probably also interacts with chromatin. Essential to maintain the shape and integrity of the nucleus, and for DNA replication. Involved in spatial organization of nuclear pore complexes. It is not a target for ced-3 during apoptosis, suggesting that lamin cleavage is not essential for apoptosis in C.elegans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.