lmn-1 Antibody

Product Discontinued

lmn-1 Antibody Summary

• Immunogen: This antibody was made against a protein fragment from the C Terminus Region
• Epitope: NSEEEQSIGGYKLVVKAGNKEASFQFSSRMKLAPHASATVWSADAGAVHHPPEVYVMKKQQWPIGDNPSARLEDSEGDTVSSITVEFSESSDPSDPADR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:100-1:2000
• Application Notes: This product is useful in ELISA and Western Blot. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:33030429).

Reactivity Notes

C. elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for lmn-1 Antibody

• LMN 1
• LMN1

Background

The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. Through alternate splicing, this gene encodes three type A lamin isoforms. Mutations in this gene lead to several diseases: Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease, and Hutchinson-Gilford progeria syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for lmn-1 Antibody (38530002)(3)

Publications using 38530002

• Velez-Aguilera G, Nkombo Nkoula S, Ossareh-Nazari B et al. PLK-1 promotes the merger of the parental genome into a single nucleus by triggering lamina disassembly Elife 2020-10-08 [PMID: 33030429] (WB, ICC/IF)
• Garrison C, Lastwika K, Zhang Y et al. Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections With Obesity J Proteome Res. 2017-01-06 [PMID: 27769113] (MiAr)
  
  Details:
  Analysis is performed on plasma proteomic data to identify how obesity can alter pathways and to highlight the risk factor for disease in subjects with a high body mass index.
• Rho JH, Lampe PD. High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays J Proteome Res. 2013-05-03 [PMID: 23541305] (MiAr)
  
  Details:
  A novel method using antibody microarrays is used to detect autoantibody-antigen complexes that can potentially be useful for detection and characterization of diseases.