lin-37 Antibody

Images

 
Western Blot: lin-37 Antibody [45170002] This image is specific to animal number SDQ3181 1:2000 of 0.5 mg/ml stock
Immunocytochemistry/ Immunofluorescence: lin-37 Antibody [45170002] - This image is specific to animal number SDQ3181 1:10,000 of 0.5 mg/ml stock
Western Blot: lin-37 Antibody [45170002] This image is specific to animal number SDQ3166 1:3000 of 0.5 mg/ml stock
Immunocytochemistry/ Immunofluorescence: lin-37 Antibody [45170002] - This image is specific to animal number SDQ3166 1:30,000 of 0.5 mg/ml stock

Product Details

Summary
Product Discontinued
View other related lin-37 Primary Antibodies

Order Details


    • Catalog Number
      45170002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

lin-37 Antibody Summary

Immunogen
In vivo generated recominant protein fragment
Epitope
LPEDGDRNARQNDPLISGGPLPLESPSRKLTSLLSYDPTVPESPDMKFARKRLGNLLTTIKHHPSEIIGVLPEDYTRADEEPGRQGRPPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1:100-1:2000
Application Notes
This product is useful for ELISA, Western Blot, and Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for lin-37 Antibody

  • LIN37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for lin-37 Antibody (45170002) (0)

There are no publications for lin-37 Antibody (45170002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for lin-37 Antibody (45170002) (0)

There are no reviews for lin-37 Antibody (45170002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for lin-37 Antibody (45170002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Research Areas for lin-37 Antibody (45170002)

Find related products by research area.

Blogs on lin-37

There are no specific blogs for lin-37, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our lin-37 Antibody and receive a gift card or discount.