We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

LET-418 Antibody

Images

 
Western Blot: LET-418 Antibody [38640002] This image is specific to animal number SDQ2342 dilution 1: 10 000 Use proteinases inhibitors
Immunocytochemistry/ Immunofluorescence: LET-418 Antibody [38640002] - This image is specific to animal number SDQ2342 dilution 1:25 000 MeOH fixation
Western Blot: LET-418 Antibody [38640002] This image is specific to animal number SDQ2339 Some protein products degradations. Use proteinases inhibitors dilution: 1:10 000
Immunocytochemistry/ Immunofluorescence: LET-418 Antibody [38640002] - This image is specific to animal number SDQ2339 dilution 1:25000 MeOH fixation

Product Details

Summary
Product Discontinued
View other related LET-418 Primary Antibodies

Order Details


    • Catalog Number
      38640002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LET-418 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
IQPKFAALYSKFMSENGERMEEDEPVEAEEEEGVKQEPDDETQDSAEAPPVLSAEVNSDDSNDVPSTSAAAAVSSETAADAEPASAEDQAPTDEPEPMET
Specificity
Caenorhabditis elegans Let-418
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1:100-1:2000
Application Notes
This product is useful for ELISA, Western Blot, and Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for LET-418 Antibody

  • Protein LET-418

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for LET-418 Antibody (38640002) (0)

There are no publications for LET-418 Antibody (38640002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LET-418 Antibody (38640002) (0)

There are no reviews for LET-418 Antibody (38640002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LET-418 Antibody (38640002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Research Areas for LET-418 Antibody (38640002)

Find related products by research area.

Blogs on LET-418

There are no specific blogs for LET-418, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LET-418 Antibody and receive a gift card or discount.

Bioinformatics

Entrez
Uniprot