Recombinant Human KRTAP4-4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human KRTAP4-4 Protein [H00084616-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human KRTAP4-4 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human KRTAP4-4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTCCRTTCCRPSCCVSRCYRPHCGQSLCC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
KRTAP4-4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
44.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KRTAP4-4 GST (N-Term) Protein

  • KAP4.13Ultrahigh sulfur keratin-associated protein 4.4
  • KAP4.4KRTAP4-13
  • keratin associated protein 4.4
  • keratin associated protein 4-13
  • keratin associated protein 4-4
  • Keratin-associated protein 4.13
  • Keratin-associated protein 4.4
  • Keratin-associated protein 4-13
  • keratin-associated protein 4-4
  • KRTAP4.13
  • KRTAP4.4
  • Ultrahigh sulfur keratin-associated protein 4.13

Background

This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for KRTAP4-4 Recombinant Protein (H00084616-P01) (0)

There are no publications for KRTAP4-4 Recombinant Protein (H00084616-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRTAP4-4 Recombinant Protein (H00084616-P01) (0)

There are no reviews for KRTAP4-4 Recombinant Protein (H00084616-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRTAP4-4 Recombinant Protein (H00084616-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRTAP4-4 Products

Array H00084616-P01

Blogs on KRTAP4-4

There are no specific blogs for KRTAP4-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KRTAP4-4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KRTAP4-4