Recombinant Human KRTAP3-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human KRTAP3-3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 98 of Human KRTAP3-3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDCCASRGCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
KRTAP3-3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human KRTAP3-3 Protein

  • High sulfur keratin-associated protein 3.3
  • KAP3.3MGC95374
  • keratin associated protein 3-3
  • Keratin-associated protein 3.3
  • keratin-associated protein 3-3
  • KRTAP3.3

Background

This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for KRTAP3-3 Recombinant Protein (H00085293-P01) (0)

There are no publications for KRTAP3-3 Recombinant Protein (H00085293-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KRTAP3-3 Recombinant Protein (H00085293-P01) (0)

There are no reviews for KRTAP3-3 Recombinant Protein (H00085293-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KRTAP3-3 Recombinant Protein (H00085293-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KRTAP3-3 Products

KRTAP3-3 H00085293-P01

Bioinformatics Tool for KRTAP3-3 Recombinant Protein (H00085293-P01)

Discover related pathways, diseases and genes to KRTAP3-3 Recombinant Protein (H00085293-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KRTAP3-3

There are no specific blogs for KRTAP3-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human KRTAP3-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KRTAP3-3