KCTD4 Antibody

Images

 
Western Blot: KCTD4 Antibody [H00386618-B01P] - Analysis of KCTD4 expression in Raw 264.7.
Western Blot: KCTD4 Antibody [H00386618-B01P] - Analysis of KCTD4 expression in IMR-32.
Western Blot: KCTD4 Antibody [H00386618-B01P] - Analysis of KCTD4 expression in transfected 293T cell line by KCTD4 polyclonal antibody. Lane 1: KCTD4 transfected lysate(28.49 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related KCTD4 Primary Antibodies

Order Details


    • Catalog Number
      H00386618-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

KCTD4 Antibody Summary

Immunogen
KCTD4 (NP_940686.1, 1 a.a. - 259 a.a.) full-length human protein. MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
Specificity
Reacts with potassium channel tetramerisation domain containing 4.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KCTD4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against cell and transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KCTD4 Antibody

  • bA321C24.3
  • BTB/POZ domain-containing protein KCTD4
  • potassium channel tetramerisation domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCTD4 Antibody (H00386618-B01P) (0)

There are no publications for KCTD4 Antibody (H00386618-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCTD4 Antibody (H00386618-B01P) (0)

There are no reviews for KCTD4 Antibody (H00386618-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KCTD4 Antibody (H00386618-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCTD4 Products

Bioinformatics Tool for KCTD4 Antibody (H00386618-B01P)

Discover related pathways, diseases and genes to KCTD4 Antibody (H00386618-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on KCTD4

There are no specific blogs for KCTD4, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCTD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCTD4
Entrez
Uniprot