Junctional Cadherin Complex Regulator Antibody - BSA Free

Images

 
Western Blot: Junctional Cadherin Complex Regulator Antibody [NBP2-87651] - Host: Rabbit. Target Name: C11ORF63. Sample Tissue: Human RPMI 8226 Whole Cell lysates. Antibody Dilution: 1ug/ml

Order Details


    • Catalog Number
      NBP2-87651
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Junctional Cadherin Complex Regulator Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Junctional Cadherin Complex Regulator Antibody - BSA Free (NBP2-87651) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Junctional Cadherin Complex Regulator. Peptide sequence: HRISKDSLESDSESLTQEIMCHSEFDDRIRGNGMEPDSLDEEESPRWGSL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
JHY
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Junctional Cadherin Complex Regulator Antibody - BSA Free

  • C11orf63
  • chromosome 11 open reading frame 63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Junctional Cadherin Complex Regulator Antibody (NBP2-87651) (0)

There are no publications for Junctional Cadherin Complex Regulator Antibody (NBP2-87651).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Junctional Cadherin Complex Regulator Antibody (NBP2-87651) (0)

There are no reviews for Junctional Cadherin Complex Regulator Antibody (NBP2-87651). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Junctional Cadherin Complex Regulator Antibody (NBP2-87651) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Junctional Cadherin Complex Regulator Products

Blogs on Junctional Cadherin Complex Regulator

There are no specific blogs for Junctional Cadherin Complex Regulator, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Junctional Cadherin Complex Regulator Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol JHY