ITPRIPL1 Antibody

Product Discontinued

ITPRIPL1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to KIAA1754L(KIAA1754-like) The peptide sequence was selected from the C terminal of KIAA1754L. Peptide sequence EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPRIPL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against KIAA1754L and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ITPRIPL1 Antibody

• inositol 14,5-triphosphate receptor interacting protein-like 1
• inositol 14,5-triphosphate receptor-interacting protein-like 1
• KIAA1754L
• KIAA1754-like

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPRIPL1
• Uniprot:
  • Q6GPH6(Human)