Recombinant Virus Influenza A nucleoprotein Protein

ELISA: Recombinant Virus Influenza A nucleoprotein Protein [NBP2-26531] - Influenza A standard curve. Influenza A/NP-A mAb, clone 2F205 was used as the capture antibody. Influenza A/NP-A pAb was used as the detection antibody. Recombinant Influenza A Nucleoprotein was used as the protein standard.

SDS-Page: Recombinant Virus Influenza A nucleoprotein Protein [NBP2-26531] - Coomassie stained SDS-PAGE gel of Influenza A Nuclear Protein: 0.5 ug (lane A), 1.0 ug (lane B), 2.0 ug (Lane C) of protein was loaded and separated by 4-20% SDS-PAGE.

Product Discontinued

Recombinant Virus Influenza A nucleoprotein Protein Summary

• Description: A recombinant protein corresponding to Influenza A nucleoprotein.

  Source: Baculovirus expression vector.

  Amino Acid Sequence:
  MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVL SAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHM MIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDR NFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAEFEDLTFLARSALILRGSVAH KSCLPACVYGPAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFED LRVLSFIKGTKVLPRGKLSTRGVQIASNENMETMESSTLELRSRYWAIRTRSGGNTNQQRASAGQISI QPTFSVQRNLPFDRTTIMAAFNGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKAASPIV PSFDMSNEGSYFFGDNAEEYDN

• Preparation Method: A cDNA coding for Human Influenza-A (Influenza A virus (A/Puerto Rico/8/34/Mount Sinai (H1N1)) segment 5) nuclear protein NP was cloned into a Baculovirus expression vector. The recombinant HNP-A was purified by proprietary chromatographic techniques. This protein migrates as a 55 kDa band in SDS-PAGE. The protein concentration was estimated by a BioRad Assay. The purity of the recombinant protein is over 95%.
• Source: Sf 21 (baculovirus)
• Protein/Peptide Type: Recombinant Protein
• Purity: >95%, by SDS-PAGE

Applications/Dilutions

• Application Notes: Use in ELISA and Western blot reported in scientific literature (PMID 25677970)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from 1M sodium chloride.
• Concentration: LYOPH
• Purity: >95%, by SDS-PAGE
• Reconstitution Instructions: Rehydrate with sterile water. For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Alternate Names for Recombinant Virus Influenza A nucleoprotein Protein

• Influenza A virus NP
• NP
• NP-A
• Nucleocapsid protein
• Nucleoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Influenza A nucleoprotein Recombinant Protein (NBP2-26531)(12)

Publications using NBP2-26531

• Nahampun HN, Bosworth B, Cunnick J et al. Expression of H3N2 nucleoprotein in maize seeds and immunogenicity in mice Plant Cell Rep. 2015 Feb 13 [PMID: 25677970] (WB, ELISA)
• Shen X, S0derholm J, Lin F et al. Influenza A vaccines using linear expression cassettes delivered via electroporation afford full protection against challenge in a mouse model. Vaccine. 2012 Nov 6 [PMID: 22406460]
  
  Details:
  ELISA: The IMR-274 NP-A recombinant protein was used to detect antibody responses in the serum of mice immunized with plasmids encoding NP two weeks following the last immunization (Fig 3a). NP-A (IMR-274) was coated onto a Nunc Maxi-Sorp Immuno Plate at
• Buriani G, Mancini C, Benvenuto E, Baschieri S. Heat-shock protein 70 from plant biofactories of recombinant antigens activate multiepitope-targeted immune responses. Plant Biotechnol J. 2012 Apr [PMID: 22221920]
  
  Details:
  ELISA in plants and mice: 1. Recombinant Influenza A Nucleoprotein (NP-A, IMR-274), Protein standard (Fig 1A) and ELISA capture (Fig 6).
• Quinn K, Quirion MR, Lo CY et al. Intranasal administration of adeno-associated virus type 12 (AAV12) leads to transduction of the nasal epithelia and can initiate transgene-specific immune response. Mol Ther. 2011 Nov [PMID: 21829176]
  
  Details:
  (2011). ELISA: Detection of antibody responses to NP-A after virus vaccination in mice (Fig 5). NP-A (IMR-274) was coated onto ELISA plates at 1 ug/ml in PBS buffer, blocked for 2 h with 1% FBS in PBS and the incubated with fourfold serially diluted serum
• Soboleski MR, Gabbard JD, Price GE et al. Cold-adapted influenza and recombinant adenovirus vaccines induce cross-protective immunity against pH1N1 challenge in mice. PLoS One. 2011 [PMID: 21789196]
  
  Details:
  ELISA: Detection of antibody responses to NP-A in the serum of immunized in mice at various time points following virus immunization (Fig 1). NP-A (IMR-274) was coated onto ELISA plates at 1 ug/ml in 0.125 saline, 0.007 M borate buffer overnight. at 4 deg
• Jelinek I, Leonard JN, Price GE et al. TLR3-specific double-stranded RNA oligonucleotide adjuvants induce dendritic cell cross-presentation, CTL responses, and antiviral protection. J Immunol. 2011 Feb 15 [PMID: 21242525]
  
  Details:
  Immunization (Fig 7): Mice were immunized with 20 ug NP-A (IMR-274) alone or in combination with either dsRNA oligonucleotides (10 ug) or polyinosinic:polycytidylic acid (10 ug) in the rear quadricepts, 7-10 mice/group. Four weeks post immunization, the animal groups were boosted using the same protocol. Three weeks after boosting, the mice were challenged with influenza virus and monitored for survival.
• Lin F, Shen X, McCoy JR et al. A novel prototype device for electroporation-enhanced DNA vaccine delivery simultaneously to both skin and muscle. Vaccine. 2011 Sep 9 [PMID: 21199706]
• Blitvich BJ, Ibarra-Juarez LA, Cortes-Guzman AJ et al. Seroprevalence of equine influenza virus in north-east and southern Mexico. Vet Rec. 2010 May 1 [PMID: 20435984] (Human)
  
  Details:
  ELISA, the IMR-274 recombinant protein was used in ELISA to evaluate antibodies to influenza virus sub-types in human serum samples. Data described but not shown.
• Rao SS, Kong WP, Wei CJ et al. Comparative efficacy of hemagglutinin, nucleoprotein, and matrix 2 protein gene-based vaccination against H5N1 influenza in mouse and ferret. PLoS One. 2010 Mar 23 [PMID: 20352112]
  
  Details:
  ELISA: Detection of humoral immune responses to NP after DNA vaccination in mice (Fig 2) or ferrets (Fig 4). The recombinant Influenza A nucleoprotein (NP-A) IMR-274 was used to coat ELISA plates.
• Price GE, Soboleski MR, Lo CY et al. Vaccination focusing immunity on conserved antigens protects mice and ferrets against virulent H1N1 and H5N1 influenza A viruses. Vaccine. 2009 Nov 5 [PMID: 19729082]
  
  Details:
  ELISA (Fig 1): Detection of immune responses to NP after influenza A plasmid immunization in mice. NP-A (IMR-274) was used to coat ELISA plates. Antibody levels were measured in serum, nasal wash and brochoalveolar lavage. Data was expressed as endpoint titers defined as the highest dilution of sample giving an OD 405 nm reader greater than three SD above the mean of naive samples.
• Sullivan HJ, Blitvich BJ, VanDalen K et al. Evaluation of an epitope-blocking enzyme-linked immunosorbent assay for the detection of antibodies to influenza A virus in domestic and wild avian and mammalian species. J Virol Methods. 2009 Oct [PMID: 19523985]
  
  Details:
  Epitope-blocking ELISA (bELISA): Tables 1, 2 Fig 1, Detection of antibodies to influenza A virus in taxonomically diverse domestic and wild vertebrate species, and mammalian species. The assay was first developed using raccoon and mallard serum. Serum from both naturally exposed and influenza A virus experimentally challenged animals was evaluated. Then sera from 215 birds and 38 mammals was used for further bELISA studies. For the bELISA studies, wells of 96-well ELISA plates were each coated 100 ul (143 mg/ml) of NP-A (IMR-274) in carbonate-bicarbonate buffer (50 mM sodium carbonate, 50 mM sodium bacarbonate, pH 9.6) and incubated overnight at 4 degrees C. See publication for additional assay details.
• Nichols JE, Cortiella J, Lee J et al. In vitro analog of human bone marrow from 3D scaffolds with biomimetic inverted colloidal crystal geometry. Biomaterials. 2009 Feb [PMID: 19042018]
  
  Details:
  ELISA (Fig 3J): 1. Recombinant Influenza A Nucleoprotein (A/NP-A: IMR-274), Protein Standard 2. Influenza A/NP-A pAb (IMX-5214), Capture antibody 3. Influenza A/NP-A mAb (IMG-5134A), Detection antibody.

FAQs for Influenza A nucleoprotein Recombinant Protein (NBP2-26531). (Showing 1 - 1 of 1 FAQs).

1. For the product #NBP2-26531 (Influenza A nucleo-protein), could you let us know the buffer (solvent) composition? Is it no preservative?
   • Our Influenza A nucleoprotein with catalogue number NBP2-26531 is lyophilized from 1M sodium chloride. The protein should be reconstituted with sterile water. For long-term storage it is recommended to add a carrier protein (0.1% HSA or BSA), and to avoid freeze-thaw cycles.