Human Coronavirus Spike S1 Antibody [CoraFluor™ 1]

Images

 
CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible ...read more

Product Details

Summary
Product Discontinued
View other related Human Coronavirus Spike S1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-37887CL1
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Human Coronavirus Spike S1 Antibody [CoraFluor™ 1] Summary

Description
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

CoraFluor(TM) 1, amine reactive

CoraFluor(TM) 1, thiol reactive

For more information, please see our CoraFluor(TM) TR-FRET technology flyer.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).

Sequence:
TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark. Do not freeze.
Buffer
PBS
Preservative
No Preservative
Purity
Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Human Coronavirus Spike S1 Antibody (NBP3-37887CL1) (0)

There are no publications for Human Coronavirus Spike S1 Antibody (NBP3-37887CL1).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Human Coronavirus Spike S1 Antibody (NBP3-37887CL1) (0)

There are no reviews for Human Coronavirus Spike S1 Antibody (NBP3-37887CL1). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Human Coronavirus Spike S1 Antibody (NBP3-37887CL1) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Human Coronavirus Spike S1 Products

Blogs on Human Coronavirus Spike S1

There are no specific blogs for Human Coronavirus Spike S1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Human Coronavirus Spike S1 Antibody [CoraFluor™ 1] and receive a gift card or discount.