Human Coronavirus Spike S1 Antibody [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Human Coronavirus Spike S1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-37887AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Human Coronavirus Spike S1 Antibody [Alexa Fluor® 488] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1074-1173 of coronavirus Spike S1 (NP_073551.1).

Sequence:
TGRGDCKGFSSDVLSDVIRYNLNFEENLRRGTILFKTSYGVVVFYCTNNTLVSGDAHIPFGTVLGNFYCFVNTTIGNETTSAFVGALPKTVREFVISRTGH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Human Coronavirus Spike S1 Antibody (NBP3-37887AF488) (0)

There are no publications for Human Coronavirus Spike S1 Antibody (NBP3-37887AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Human Coronavirus Spike S1 Antibody (NBP3-37887AF488) (0)

There are no reviews for Human Coronavirus Spike S1 Antibody (NBP3-37887AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Human Coronavirus Spike S1 Antibody (NBP3-37887AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Human Coronavirus Spike S1 Products

Array NBP3-37887AF488

Blogs on Human Coronavirus Spike S1

There are no specific blogs for Human Coronavirus Spike S1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Human Coronavirus Spike S1 Antibody [Alexa Fluor® 488] and receive a gift card or discount.