him-8 Antibody

Immunocytochemistry/Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2975 him(tm611) mutant (negative control) staining. Data set was taken around late transition zone/pachytene. Affinity purified antibody dilluted 1:10000

Immunocytochemistry/Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2972 wild type Dilution: 1:10000 Affinity Purified

Immunocytochemistry/Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2972 him(tm611) mutant (negative control) staining. Data set was taken around transition zone/early pachytene. Affinity purified antibody dilluted 1:10000

Immunocytochemistry/Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2975 Wild type 1:10000 Affinity Purified

Product Discontinued

him-8 Antibody Summary

• Immunogen: This antibody is specific for C. elegans him-8
• Epitope: RLIDHALVHCDKNFLKCKKCKHTCHTIRQMRYHYRIFHSTSKMEGFGVSGLPTKNKGFQKIMNACFADQLVEMNKRKNPPKSQNGSRRSRVKSKSKRSGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIM8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry Whole-Mount
  • Immunohistochemistry
• Application Notes: Use in IHC reported in scientific literature (PMID:34376665).

Reactivity Notes

Use in C. elegans reported in scientific literature (PMID:34252074)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for him-8 Antibody

• HIM-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for him-8 Antibody (41980002)(9)

Publications using 41980002

• Wang S, Meyer DH, Schumacher B Inheritance of paternal DNA damage by histone-mediated repair restriction Nature 2023-01-01 [PMID: 36544019] (IHC-Fr, Worm)
  
  Details:
  1:100 IHC-Fr dilution
• Rappaport Y, Achache H, Falk R Et al. Bisection of the X chromosome disrupts the initiation of chromosome silencing during meiosis in Caenorhabditis elegans Nature communications 2021-08-10 [PMID: 34376665] (IF/IHC)
• Velkova M, Silva N, Dello Stritto Mr Et Al. Caenorhabditis elegans RMI2 functional homolog-2 (RMIF-2) and RMI1 (RMH-1) have both overlapping and distinct meiotic functions within the BTR complex PLoS genetics 2021-07-01 [PMID: 34252074] (ICC/IF)
• Lascarez-Lagunas LI, Herruzo E, Grishok A et al. DOT-1.1-dependent H3K79 methylation promotes normal meiotic progression and meiotic checkpoint function in C. elegans PLoS Genet 2020-10-26 [PMID: 33104701] (IHC-WhMt, C. elegans)
• Castellano-Pozo M, Pacheco S, Sioutas G et al. Surveillance of cohesin-supported chromosome structure controls meiotic progression Nat Commun 2020-08-28 [PMID: 32859945]
• Nguyen H, Labella S, Silva N et al. C. elegans ZHP-4 is required at multiple distinct steps in the formation of crossovers and their transition to segregation competent chiasmata. PLoS Genet. 2018-10-01 [PMID: 30379819] (ICC/IF, C. elegans)
• Koury E, Harrell K, Smolikove S. Differential RPA-1 and RAD-51 recruitment in vivo throughout the C. elegans germline, as revealed by laser microirradiation. Nucleic Acids Res. 2017-12-13 [PMID: 29244155] (C. elegans)
• Crawley O, Barroso C, Testori S et al. Cohesin-interacting protein WAPL-1 regulates meiotic chromosome structure and cohesion by antagonizing specific cohesin complexes. Elife. 2016-02-04 [PMID: 26841696] (ICC/IF, C. elegans)
• Woglar A, Daryabeigi A, Adamo A. Matefin/SUN-1 Phosphorylation Is Part of a Surveillance Mechanism to Coordinate Chromosome Synapsis and Recombination with Meiotic Progression and Chromosome Movement PLoS Genet 2013-03-01 [PMID: 23505384] (ICC/IF, C. elegans)

Bioinformatics

• Gene Symbol: HIM8
• Entrez:
  • 188247(C. elegans)
• Uniprot:
  • O18068(C. elegans)