him-8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2975 him(tm611) mutant (negative control) staining. Data set was taken around late transition ...read more
Immunocytochemistry/ Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2972 wild type Dilution: 1:10000 Affinity Purified
Immunocytochemistry/ Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2972 him(tm611) mutant (negative control) staining. Data set was taken around transition zone/early ...read more
Immunocytochemistry/ Immunofluorescence: him-8 Antibody [41980002] - This image is specific to animal number SDQ2975 Wild type 1:10000 Affinity Purified

Product Details

Summary
Reactivity CeSpecies Glossary
Applications ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

him-8 Antibody Summary

Immunogen
This antibody is specific for C. elegans him-8
Epitope
RLIDHALVHCDKNFLKCKKCKHTCHTIRQMRYHYRIFHSTSKMEGFGVSGLPTKNKGFQKIMNACFADQLVEMNKRKNPPKSQNGSRRSRVKSKSKRSGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HIM8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA and for Immunofluorescence.
Publications
Read Publications using
41980002 in the following applications:

Reactivity Notes

This Antibody is reactive to C. elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for him-8 Antibody

  • HIM-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for him-8 Antibody (41980002)(4)

Reviews for him-8 Antibody (41980002) (0)

There are no reviews for him-8 Antibody (41980002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for him-8 Antibody (41980002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional him-8 Products

Array 41980002

Bioinformatics Tool for him-8 Antibody (41980002)

Discover related pathways, diseases and genes to him-8 Antibody (41980002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for him-8 Antibody (41980002)

Find related products by research area.

Blogs on him-8

There are no specific blogs for him-8, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our him-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HIM8
Entrez
Uniprot