HERPUD2 Antibody

Product Discontinued

HERPUD2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to HERPUD2(HERPUD family member 2) The peptide sequence was selected from the N terminal of HERPUD2 (NP_071768). Peptide sequence MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Zebrafish (92%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HERPUD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HERPUD2 Antibody

• endoplasmic reticulum stress-inducible, ubiquitin-likedomain member 2
• FLJ22313
• FLJ31032
• HERPUD family member 2
• homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domainmember 2 protein

Background

HERPUD2 could be involved in the unfolded protein response (UPR) pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HERPUD2
• Entrez:
  • 64224(Human)
• Uniprot:
  • Q9BSE4(Human)