gfl-1 Antibody

Images

 
Genetic Strategies: Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0834 Experimental design: RNAi was carried out in rrf-3 worms with bacteria carrying empty vector or ...read more
Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0871 Experimental design: RNAi was carried out in nf-3 worms with bacteria carrying empty vector or a construct targeting GFL-1. L1 ...read more

Product Details

Summary
Product Discontinued
View other related gfl-1 Primary Antibodies
Validated by:
     

Genetic Strategies

   

Order Details


    • Catalog Number
      29640002
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

gfl-1 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment GFL1
Epitope
RLFQPTIELPSGNQIVCMEFYDEIIFQEPTVQMYKALQASDGKRPDKQAFLNDIEQVKTRTRELGEVAQKEIAAEIEDLRESLKDAHKMIVKYNTELAEQ
Specificity
This GFL-1 antibody is specific for C. Elegans GFL-1
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
gfl-1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA, Immunofluorescence and Western Blot.
Publications
Read Publications using 29640002.

Reactivity Notes

C. elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for gfl-1 Antibody

  • gfl1
  • M04B2.3
  • Protein M04B2.3

Background

gfl-1 encodes an ortholog of human GLIOMA-AMPLIFIED SEQUENCE-41 (GAS41; OMIM:602116, found in increased copy number in low-grade glioma); loss of GLF-1, which is predicted to associate with chromatin, results in potent suppression of the RNA interference (RNAi) mechanism; GLF-1 is also similar to the transcription factors (yeast and human) AF-9 and human ENL, and thus may represent a novel class of transcription factors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for gfl-1 Antibody (29640002)(2)

Reviews for gfl-1 Antibody (29640002) (0)

There are no reviews for gfl-1 Antibody (29640002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for gfl-1 Antibody (29640002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Bioinformatics Tool for gfl-1 Antibody (29640002)

Discover related pathways, diseases and genes to gfl-1 Antibody (29640002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for gfl-1 Antibody (29640002)

Find related products by research area.

Blogs on gfl-1

There are no specific blogs for gfl-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gfl-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol gfl-1
Entrez
Uniprot