FBXW9 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FBXW9 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXW9.
  
  

  Source: E. coli

  Amino Acid Sequence: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FBXW9
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84714.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXW9 Recombinant Protein Antigen

• F-box and WD repeat domain containing 9
• F-box and WD-40 domain protein 9
• F-box and WD-40 domain-containing protein 9
• F-box and WD-40 repeat containing protein 9
• specificity factor for SCF ubiquitin ligase

Background

FBXW9, also known as F-box/WD repeat-containing protein 9, has 3 isoforms, a 488 amino acid isoform that is 54 kDa, a 478 amino acid isoform that is 53 kDa and a 458 amino acid isoform that is 51 kDa; acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. The protein is being studied for its involvement in neuronitis. FBXW9 has been shown to have interactions with SKP1, COPS6 and UBC in association of TriC/CCT with target proteins during biosynthesis, chaperonin-mediated protein folding, metabolism of proteins, and protein folding pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FBXW9