FBXO16 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FBXO16 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for FBXO16 Antibody
Background
The FBXO15 gene encodes a f-box only protein 16 that in isoform 1 is 292 amino acids long and 34 kDA and in isoform 2 is 280 amino acids long at 33 kDA. This protein is thought to recognize as well as bind to various phosphorylated proteins in encouraging their ubiquination and degradation. FBXO15 interacts with genes SKP1 and UBC and is associated to anemia and cholangiocarcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for FBXO16 Antibody (NBP2-33700) (0)
There are no publications for FBXO16 Antibody (NBP2-33700).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FBXO16 Antibody (NBP2-33700) (0)
There are no reviews for FBXO16 Antibody (NBP2-33700).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FBXO16 Antibody (NBP2-33700) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FBXO16 Products
Blogs on FBXO16