FBXO16 Antibody

Immunohistochemistry: FBXO16 Antibody [NBP2-33700] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

FBXO16 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXO16 Antibody

• F-box only protein 16
• F-box protein 16
• FBX16MGC125925
• MGC125923
• MGC125924

Background

The FBXO15 gene encodes a f-box only protein 16 that in isoform 1 is 292 amino acids long and 34 kDA and in isoform 2 is 280 amino acids long at 33 kDA. This protein is thought to recognize as well as bind to various phosphorylated proteins in encouraging their ubiquination and degradation. FBXO15 interacts with genes SKP1 and UBC and is associated to anemia and cholangiocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO16
• Uniprot:
  • Q8IX29(Human)