FAM35A Antibody

Western Blot: FAM35A Antibody [NBP1-88980] - Analysis in human cell line U-937 MG.

Immunocytochemistry/Immunofluorescence: FAM35A Antibody [NBP1-88980] - Staining of human cell line U-2 OS shows localization to nucleoplasm & actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FAM35A Antibody [NBP1-88980] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: FAM35A Antibody [NBP1-88980] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: FAM35A Antibody [NBP1-88980] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: FAM35A Antibody [NBP1-88980] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Discontinued

FAM35A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNMQICGFKSTVPHFTEEEKYQKLLSENKIRDEQPKHQPD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM35A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM35A Antibody

• bA163M19.1
• FAM35A1
• family with sequence similarity 35, member A
• hypothetical protein LOC54537
• MGC5560

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM35A Antibody (NBP1-88980)(1)

Publication using NBP1-88980

• Yunhui Li, Lei Li, Xinshu Wang, Fei Zhao, Yuntong Yang, Yujuan Zhou, Jiyuan Zhang, Li Wang, Zeshan Jiang, Yuanyuan Zhang, Yuping Chen, Chenming Wu, Ke Li, Tingting Zhang, Ping Wang, Zhiyong Mao, Weiguo Zhu, Xingzhi Xu, Shikang Liang, Zhenkun Lou, Jian Yuan USP25 Elevates SHLD2-Mediated DNA Double-Strand Break Repair and Regulates Chemoresponse in Cancer. Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2024-05-27 [PMID: 38803048]

Bioinformatics

• Gene Symbol: FAM35A