![Immunocytochemistry/Immunofluorescence: FAM208A Antibody [NBP1-90673] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FAM208A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90673-img0005.jpg "Immunocytochemistry/Immunofluorescence: FAM208A Antibody [NBP1-90673] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLES |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM208A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: 24781204). |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-90673 | Applications | Species |
|---|---|---|
| Harten SK, Bruxner TJ, Bharti V et al. The first mouse mutants of D14Abb1e (Fam208a) show that it is critical for early development. Mamm Genome 2014-08-01 [PMID: 24781204] (WB, IF/IHC, Mouse) | WB, IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM208A |
![Immunohistochemistry-Paraffin: FAM208A Antibody [NBP1-90673] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FAM208A-Antibody-Immunohistochemistry-Paraffin-NBP1-90673-img0007.jpg "Immunohistochemistry-Paraffin: FAM208A Antibody [NBP1-90673] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: FAM208A Antibody [NBP1-90673] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/FAM208A-Antibody-Immunohistochemistry-Paraffin-NBP1-90673-img0008.jpg "Immunohistochemistry-Paraffin: FAM208A Antibody [NBP1-90673] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.")