![Western Blot: FAM155A Antibody [NBP2-55425] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.](http://images.novusbio.com/fullsize/FAM155A-Antibody-Western-Blot-NBP2-55425-img0002.jpg "Western Blot: FAM155A Antibody [NBP2-55425] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DNDEVIYGGLSSFICTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NALF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NALF1 |
![Immunocytochemistry/Immunofluorescence: FAM155A Antibody [NBP2-55425] - Staining of human cell line RT4 shows localization to nucleus & vesicles.](http://images.novusbio.com/fullsize/FAM155A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55425-img0001.jpg "Immunocytochemistry/Immunofluorescence: FAM155A Antibody [NBP2-55425] - Staining of human cell line RT4 shows localization to nucleus & vesicles.")