![Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] - Staining of human kidney shows strong membranous and weak cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/antibody/nbp1-81636_rabbit-polyclonal-fam126b-antibody-immunohistochemistry-paraffin-2942024125846..jpg "Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] - Staining of human kidney shows strong membranous and weak cytoplasmic positivity in cells in tubules.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS |
| Predicted Species | Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM126B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81636 | Applications | Species |
|---|---|---|
| Shuang Li, Ting Han Frequent loss of FAM126A expression in colorectal cancer results in selective FAM126B dependency iScience 2024-03-29 [PMID: 38638566] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM126B |
![Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human stomach shows moderate membranous/cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-81636_rabbit-polyclonal-fam126b-antibody-immunohistochemistry-paraffin-2942024125938..jpg "Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human stomach shows moderate membranous/cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil and weak membranous positivity in neurons.](http://images.novusbio.com/fullsize/antibody/nbp1-81636_rabbit-polyclonal-fam126b-antibody-immunohistochemistry-paraffin-294202413032..jpg "Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil and weak membranous positivity in neurons.")
![Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-81636_rabbit-polyclonal-fam126b-antibody-immunohistochemistry-paraffin-294202413127..jpg "Immunohistochemistry-Paraffin: FAM126B Antibody [NBP1-81636] -Staining of human prostate shows no positivity in glandular cells as expected.")
![Western Blot: FAM126B Antibody [NBP1-81636] -Analysis in human cell line NB4.](http://images.novusbio.com/fullsize/antibody/nbp1-81636_rabbit-polyclonal-fam126b-antibody-western-blot-5320257413..png "Western Blot: FAM126B Antibody [NBP1-81636] -Analysis in human cell line NB4.")