We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FAM115A Antibody - BSA Free

Images

 
Western Blot: FAM115A Antibody [NBP2-84880] - Host: Rabbit. Target Name: FAM115A. Sample Tissue: Human COLO205 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Product Discontinued
View other related FAM115A Primary Antibodies

Order Details


    • Catalog Number
      NBP2-84880
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FAM115A Antibody - BSA Free Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM115A. Peptide sequence: FTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVAT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FAM115A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for FAM115A Antibody - BSA Free

  • family with sequence similarity 115, member A
  • hypothetical protein LOC9747
  • KIAA0738FLJ56782

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM115A Antibody (NBP2-84880) (0)

There are no publications for FAM115A Antibody (NBP2-84880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM115A Antibody (NBP2-84880) (0)

There are no reviews for FAM115A Antibody (NBP2-84880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM115A Antibody (NBP2-84880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM115A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM115A