Recombinant Human FAM113A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FAM113A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-454 of Human C20orf81 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVFCLSSEEPRRPLRSDMVHFQASEVQQLLHNKFVVILGDSIQRAVYKDLVLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFCSGSGHHLVRFYFLTRVYSEYLEDVLEELTYGPAPDLVIINSCLWDLSRYGRCSMESYRENLERVFVRMDQVLPDSCLLVWNMAMPLGERITGGFLLPELQPLAGSLRRDVVEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSHLLLTHVADAWGVELPKRGYPPDPWIEDWAEMNHPFQGSHRQTPDFGEHLALLPPPPSSLPPPMPFPYPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PCED1A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM113A Protein

  • bA12M19.1
  • C20orf81
  • chromosome 20 open reading frame 81
  • DKFZp547L054
  • family with sequence similarity 113, member A
  • FLJ22376
  • hypothetical protein LOC64773
  • Sarcoma antigen NY-SAR-23

Background

C20orf81( AAH37240, 1 a.a. - 455 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for FAM113A Recombinant Protein (H00064773-P01) (0)

There are no publications for FAM113A Recombinant Protein (H00064773-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM113A Recombinant Protein (H00064773-P01) (0)

There are no reviews for FAM113A Recombinant Protein (H00064773-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM113A Recombinant Protein (H00064773-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM113A Products

Bioinformatics Tool for FAM113A Recombinant Protein (H00064773-P01)

Discover related pathways, diseases and genes to FAM113A Recombinant Protein (H00064773-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM113A

There are no specific blogs for FAM113A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAM113A Antibody
NBP2-13976

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM113A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCED1A