FAM108B1 Antibody

Product Discontinued

FAM108B1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to FAM108B1(family with sequence similarity 108, member B1) The peptide sequence was selected from the middle region of FAM108B1. Peptide sequence SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD17B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against FAM108B1 and was validated on Western blot.
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM108B1 Antibody

• abhydrolase domain-containing protein FAM108B1
• C9orf77
• CGI-67
• chromosome 9 open reading frame 77
• EC 3.-
• family with sequence similarity 108, member B1
• RP11-409O11.2

Background

FAM108B1 belongs to the AB hydrolase superfamily.fAM108 family. The exact function of FAM108B1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABHD17B
• Uniprot:
  • Q5VST6(Human)