ERVMER34-1 Antibody

Images

 
Immunohistochemistry-Paraffin: ERVMER34-1 Antibody [NBP2-14484] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ERVMER34-1 Antibody [NBP2-14484] - Staining of human placenta shows cytoplasmic positivity in decidual cells
Immunohistochemistry-Paraffin: ERVMER34-1 Antibody [NBP2-14484] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ERVMER34-1 Antibody [NBP2-14484] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERVMER34-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERVMER34-1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERVMER34-1 Protein (NBP2-14484PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERVMER34-1 Antibody

  • EnvMER34
  • ERVMER34-1 endogenous retrovirus group MER34, member 1
  • ERVMER34-1
  • HEMO
  • HERV-MER_4q12 Provirus Ancestral Env Polyprotein
  • LP9056 Protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ERVMER34-1 Antibody (NBP2-14484) (0)

There are no publications for ERVMER34-1 Antibody (NBP2-14484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERVMER34-1 Antibody (NBP2-14484) (0)

There are no reviews for ERVMER34-1 Antibody (NBP2-14484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ERVMER34-1 Antibody (NBP2-14484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERVMER34-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERVMER34-1