dpy-28 Antibody

Images

 
Western Blot: dpy-28 Antibody [53250002] This image is specific to animal number SDQ4564
Western Blot: dpy-28 Antibody [53250002] This image is specific to animal number SDQ4495

Product Details

Summary
Reactivity CeSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

dpy-28 Antibody Summary

Immunogen
In vivo generated recominant protein fragment
Epitope
QQQPTRNNDGLSGFKSITEIIAEADNNIPSEQIDKDIDSFSSYSDISDWRGIPKFFPSLSSLSRRASTYENWENRFKVVDYLVSCSGALKDSVSDYVADY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • ELISA 1:100-1:2000
Application Notes
This product is useful in ELISA and Western Blot.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for dpy-28 Antibody

  • DPY28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Supplier Logo

Publications for dpy-28 Antibody (53250002) (0)

There are no publications for dpy-28 Antibody (53250002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dpy-28 Antibody (53250002) (0)

There are no reviews for dpy-28 Antibody (53250002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for dpy-28 Antibody (53250002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional dpy-28 Products

dpy-28 53250002

Research Areas for dpy-28 Antibody (53250002)

Find related products by research area.

Blogs on dpy-28

There are no specific blogs for dpy-28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dpy-28 Antibody and receive a gift card or discount.