| Reactivity | HuSpecies Glossary |
| Applications | PAGE, Bioactivity |
| Concentration | LYOPH |
| Description | A recombinant protein corresponding to the amino acids 24-64 of Human DEFB4B Source: Escherichia coli Amino Acid Sequence: VFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Preparation Method |
Escherichia coli expression system |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein |
| Gene | DEFB4B |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Endotoxin Note | < 0.1 ng/ug (1 EU/ug) |
| Dilutions |
|
| Theoretical MW | 4 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20 to -70C as supplied. After reconstitution, store at 2 to 8C for 1 month and at -20 to -70C for long term storage. Avoid repeated freeze-thaw cycles. |
| Buffer | Lyophilized from 100mM NaCl, 20mM PB, pH 7.4 |
| Preservative | No Preservative |
| Concentration | LYOPH |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Reconstitution Instructions | Reconstitute with deionized water. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DEFB4B |
