DCAF16 Antibody

Immunocytochemistry/Immunofluorescence: DCAF16 Antibody [NBP1-91166] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DCAF16 Antibody [NBP1-91166] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: DCAF16 Antibody [NBP1-91166] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DCAF16 Antibody [NBP1-91166] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DCAF16 Antibody [NBP1-91166] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

DCAF16 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SYLNESSGEEWDSSEEEDSMVPNLSPLESLAWQVKCLLKYSTTWKPLNPNSWLYHAKLLDPSTPVHILREIGLRLSHCSHCVPKLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCAF16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DCAF16 Antibody

• C4orf30
• DDB1 and CUL4 associated factor 16
• FLJ20280

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCAF16