Recombinant Human Connexin 25/GJB7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Connexin 25/GJB7 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 223 of Human GJB7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GJB7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Connexin 25/GJB7 Protein

  • bA136M9.1
  • Connexin 25
  • connexin25
  • Connexin-25
  • CX25
  • CX25connexin-25
  • gap junction beta-7 protein
  • gap junction protein, beta 7
  • gap junction protein, beta 7, 25kDa
  • GJB7
  • MGC71746

Background

Connexins, such as GJB7, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Connexin 25/GJB7 Recombinant Protein (H00375519-P01) (0)

There are no publications for Connexin 25/GJB7 Recombinant Protein (H00375519-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 25/GJB7 Recombinant Protein (H00375519-P01) (0)

There are no reviews for Connexin 25/GJB7 Recombinant Protein (H00375519-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Connexin 25/GJB7 Recombinant Protein (H00375519-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 25/GJB7 Products

Bioinformatics Tool for Connexin 25/GJB7 Recombinant Protein (H00375519-P01)

Discover related pathways, diseases and genes to Connexin 25/GJB7 Recombinant Protein (H00375519-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Connexin 25/GJB7 Recombinant Protein (H00375519-P01)

Discover more about diseases related to Connexin 25/GJB7 Recombinant Protein (H00375519-P01).

Blogs on Connexin 25/GJB7

There are no specific blogs for Connexin 25/GJB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Connexin 25/GJB7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GJB7
Entrez