CCER2 Antibody

Images

 
Immunohistochemistry-Paraffin: CCER2 Antibody [NBP2-49614] - Staining of human esophagus shows strong cytoplasmic and nuclear positivity in a subset of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCER2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AAPLAPRPSKEELTRCLAEVVTEVLTVGQVQRGPCTALLHKELCGTEPHGCASTEEKGLLLGDFKKQEAGKMRSSQEVRDE
Specificity
Specificity of human CCER2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCER2 Antibody

  • Coiled-Coil Glutamate-Rich Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCER2 Antibody (NBP2-49614) (0)

There are no publications for CCER2 Antibody (NBP2-49614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCER2 Antibody (NBP2-49614) (0)

There are no reviews for CCER2 Antibody (NBP2-49614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCER2 Antibody (NBP2-49614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCER2 Products

Array NBP2-49614

Bioinformatics Tool for CCER2 Antibody (NBP2-49614)

Discover related pathways, diseases and genes to CCER2 Antibody (NBP2-49614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCER2

There are no specific blogs for CCER2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCER2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCER2