CATIP Antibody - BSA Free

Images

 
Western Blot: CATIP Antibody [NBP3-10861] - Western blot analysis of CATIP in Mouse Testis lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Product Discontinued
View other related CATIP Primary Antibodies

Order Details


    • Catalog Number
      NBP3-10861
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CATIP Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CATIP Antibody - BSA Free (NBP3-10861) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of Mouse GM216 (NP_001028517.1). Peptide sequence GETASLHHPGLEDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGI
Clonality
Polyclonal
Host
Rabbit
Gene
CATIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CATIP Antibody - BSA Free

  • C2orf62
  • chromosome 2 open reading frame 62
  • hypothetical protein LOC375307
  • MGC50811

Background

Chromosome 2 is the second largest human chromosome. It makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. C2orf62 (chromosome 2 open reading frame 62), also known as MGC50811, is a 387 amino acid protein encoded by a gene that maps to human chromosome 2q35. The C2orf62 gene has been provisionally designated C2orf62 pending further characterization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CATIP Antibody (NBP3-10861) (0)

There are no publications for CATIP Antibody (NBP3-10861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CATIP Antibody (NBP3-10861) (0)

There are no reviews for CATIP Antibody (NBP3-10861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CATIP Antibody (NBP3-10861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CATIP Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CATIP