C9orf43 Antibody

Product Discontinued

C9orf43 Antibody Summary

• Immunogen: Synthetic peptides corresponding to C9ORF43 The peptide sequence was selected from the middle region of C9ORF43. Peptide sequence PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE.
• Predicted Species: Yeast (90%), Canine (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C9ORF43
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against C9orf43 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C9orf43 Antibody

• chromosome 9 open reading frame 43
• hypothetical protein LOC257169
• MGC17358

Background

The function of the C9orf43 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C9ORF43
• Uniprot:
  • Q8TAL5(Human)