We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

C8orf58 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: C8orf58 Antibody [NBP1-93836] - Staining of human cell line A-431 shows localization to nuclear bodies.
Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Product Discontinued
View other related C8orf58 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-93836
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C8orf58 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGNRGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPET
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C8orf58
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for C8orf58 Antibody - BSA Free

  • chromosome 8 open reading frame 58
  • FLJ34715

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C8orf58 Antibody (NBP1-93836) (0)

There are no publications for C8orf58 Antibody (NBP1-93836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C8orf58 Antibody (NBP1-93836) (0)

There are no reviews for C8orf58 Antibody (NBP1-93836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C8orf58 Antibody (NBP1-93836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C8orf58 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol C8orf58