Recombinant Human C8orf33 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human C8orf33 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-229 of Human FLJ20989 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
C8ORF33
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C8orf33 Protein

  • chromosome 8 open reading frame 33
  • FLJ20989
  • hypothetical protein LOC65265

Background

FLJ20989( AAH10001, 1 a.a. - 230 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for C8orf33 Recombinant Protein (H00065265-P01) (0)

There are no publications for C8orf33 Recombinant Protein (H00065265-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C8orf33 Recombinant Protein (H00065265-P01) (0)

There are no reviews for C8orf33 Recombinant Protein (H00065265-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C8orf33 Recombinant Protein (H00065265-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for C8orf33 Recombinant Protein (H00065265-P01)

Discover related pathways, diseases and genes to C8orf33 Recombinant Protein (H00065265-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C8orf33 Recombinant Protein (H00065265-P01)

Find related products by research area.

Blogs on C8orf33

There are no specific blogs for C8orf33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

C8orf33 Antibody
H00065265-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C8orf33 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C8ORF33