C2orf83 Antibody

Immunohistochemistry-Paraffin: C2orf83 Antibody [NBP1-90540] - Staining of human testis shows nuclear positivity in subsets of cells in seminiferus ducts.

Product Discontinued

C2orf83 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGMRKLTVQTCGLTFIHPAGHGLCHPTAQASAETLSSTALNRPSVREGACNEKSTENKKPQDSVLWS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C2ORF83
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C2orf83 Antibody

• chromosome 2 open reading frame 83
• folate transporter-like protein C2orf83

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C2ORF83