C2orf83 Antibody


Immunocytochemistry/ Immunofluorescence: C2orf83 Antibody [NBP1-90540] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: C2orf83 Antibody [NBP1-90540] - Staining of human testis shows nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

C2orf83 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:PGMRKLTVQTCGLTFIHPAGHGLCHPTAQASAETLSSTALNRPSVREGACNEKSTENKKPQDSVLWS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C2orf83 Protein (NBP1-90540PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C2orf83 Antibody

  • chromosome 2 open reading frame 83
  • folate transporter-like protein C2orf83


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C2orf83 Antibody (NBP1-90540) (0)

There are no publications for C2orf83 Antibody (NBP1-90540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2orf83 Antibody (NBP1-90540) (0)

There are no reviews for C2orf83 Antibody (NBP1-90540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C2orf83 Antibody (NBP1-90540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C2orf83 Products

Bioinformatics Tool for C2orf83 Antibody (NBP1-90540)

Discover related pathways, diseases and genes to C2orf83 Antibody (NBP1-90540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C2orf83

There are no specific blogs for C2orf83, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C2orf83 Antibody and receive a gift card or discount.


Gene Symbol C2ORF83