Recombinant Human C1orf54 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C1orf54 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-131 of Human FLJ23221 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
C1ORF54

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C1orf54 Protein

  • chromosome 1 open reading frame 54
  • FLJ23221
  • hypothetical protein LOC79630

Background

FLJ23221( AAH17761, 1 a.a. - 132 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for C1orf54 Recombinant Protein (H00079630-P01) (0)

There are no publications for C1orf54 Recombinant Protein (H00079630-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1orf54 Recombinant Protein (H00079630-P01) (0)

There are no reviews for C1orf54 Recombinant Protein (H00079630-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1orf54 Recombinant Protein (H00079630-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1orf54 Products

C1orf54 H00079630-P01

Bioinformatics Tool for C1orf54 Recombinant Protein (H00079630-P01)

Discover related pathways, diseases and genes to C1orf54 Recombinant Protein (H00079630-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C1orf54 Recombinant Protein (H00079630-P01)

Find related products by research area.

Blogs on C1orf54

There are no specific blogs for C1orf54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

C1orf54 Antibody
NBP1-82089

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C1orf54 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1ORF54