Recombinant Human C16orf87 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C16orf87 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 154 of Human LOC388272 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEAKRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEKEIDIYANLSDEKAFVFSVALAEINRKIINQRLIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
C16ORF87

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C16orf87 Protein

  • chromosome 16 open reading frame 87
  • hypothetical protein LOC388272
  • MGC62018

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for C16orf87 Recombinant Protein (H00388272-P01) (0)

There are no publications for C16orf87 Recombinant Protein (H00388272-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C16orf87 Recombinant Protein (H00388272-P01) (0)

There are no reviews for C16orf87 Recombinant Protein (H00388272-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C16orf87 Recombinant Protein (H00388272-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C16orf87 Products

C16orf87 H00388272-P01

Bioinformatics Tool for C16orf87 Recombinant Protein (H00388272-P01)

Discover related pathways, diseases and genes to C16orf87 Recombinant Protein (H00388272-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C16orf87

There are no specific blogs for C16orf87, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C16orf87 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C16ORF87