ARMC5 Antibody

Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human thyroid gland shows positivity in glandular cells.

Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human cerebral cortex shows positivity in neurons.

Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human endometrium shows positivity in glandular cells.

Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human pancreas shows positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human testis shows positivity in cells in seminiferous ducts.

Product Discontinued

ARMC5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSAVSSSSPTPPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARMC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Proximity Ligation Assay
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID 24601692). The predicted molecular weight of ARMC5 protein is 97.7 kDa, however, PMID 24601692 shows that in human samples, this protein runs at ~75 kDa position. WB, IHC-P reported in the scientific literature (PMID: 25822102). Use in ICC/IF, PLA reported in scientific literature (PMID:35862218).

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:28911199).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARMC5 Antibody

• armadillo repeat containing 5
• armadillo repeat-containing protein 5
• FLJ00019
• FLJ13063

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARMC5 Antibody (NBP1-94024)(8)

Publications using NBP1-94024

• de Arruda Botelho MLA, Nishi MY, Ribeiro KB, Zerbini MCN Morphological Harbingers of ARMC5-Pathogenic Variant-Related Bilateral Macronodular Adrenocortical Disease Endocrine pathology 2023-04-12 [PMID: 37043100]
• Okuno Y, Fukuhara A, Otsuki M, Shimomura I ARMC5-CUL3 E3 ligase targets full-length SREBF in adrenocortical tumor JCI insight 2022-07-21 [PMID: 35862218] (WB, PLA, ICC/IF, Human, Mouse)
• Berthon, A;Hannah-Shmouni, F;Maria, AG;Faucz, FR;Stratakis, CA; High expression of adrenal P450 aromatase (CYP19A1) in association with ARMC5-primary bilateral macronodular adrenocortical hyperplasia J. Steroid Biochem. Mol. Biol. 2019-04-20 [PMID: 31014964] (IF/IHC, Human)
• Berthon A, Faucz F R et al. Age-dependent effects of Armc5 haploinsufficiency on adrenocortical function. Hum Mol Genet 2017-09-15 [PMID: 28911199] (IF/IHC, Mouse)
• Berthon A, Faucz F, Bertherat J, Stratakis C. Analysis of ARMC5 expression in human tissues. Mol. Cell. Endocrinol. 2016-08-24 [PMID: 27568465]
• Zilbermint M, Xekouki P, Faucz FR et al. Primary Aldosteronism and ARMC5 variants J. Clin. Endocrinol. Metab. 2015-03-30 [PMID: 25822102] (WB, IHC-P, Human)
• Faucz FR, Zilbermint M, Lodish MB et al. Macronodular Adrenal Hyperplasia due to Mutations in an Armadillo Repeat Containing 5 (ARMC5) Gene: A Clinical and Genetic Investigation. J. Clin. Endocrinol. Metab. 2014-03-06 [PMID: 24601692] (WB, IHC-P, Human)
• Botelho M, Nishi M, Zerbini M Revisiting the Pathology of Bilateral Macronodular Adrenocortical Disease in Light of Recent Discoveries Research Square 2022-10-11 (IHC-P, Human)
  
  Details:
  Dilution used in IHC 1:50

Bioinformatics

• Gene Symbol: ARMC5
• Entrez:
  • 79798(Human)
• Uniprot:
  • Q96C12(Human)