ARMC5 Antibody

Images

 
Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human thyroid gland shows positivity in glandular cells.
Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human cerebral cortex shows positivity in neurons.
Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human endometrium shows positivity in glandular cells.
Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human pancreas shows positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ARMC5 Antibody [NBP1-94024] - Staining of human testis shows positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSAVSSSSPTPPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID 24601692). The predicted molecular weight of ARMC5 protein is 97.7 kDa, however, PMID 24601692 shows that in human samples, this protein runs at ~75 kDa position. WB, IHC-P reported in the scientific literature (PMID: 25822102).
Control Peptide
ARMC5 Protein (NBP1-94024PEP)
Publications
Read Publications using
NBP1-94024 in the following applications:

  • IHC
    2 publications
  • 2 publications
  • WB
    2 publications

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%) Use in Mouse reported in scientific literature (PMID:28911199).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMC5 Antibody

  • armadillo repeat containing 5
  • armadillo repeat-containing protein 5
  • FLJ00019
  • FLJ13063

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARMC5 Antibody (NBP1-94024)(5)

Reviews for ARMC5 Antibody (NBP1-94024) (0)

There are no reviews for ARMC5 Antibody (NBP1-94024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMC5 Antibody (NBP1-94024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARMC5 Products

Array NBP1-94024

Bioinformatics Tool for ARMC5 Antibody (NBP1-94024)

Discover related pathways, diseases and genes to ARMC5 Antibody (NBP1-94024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARMC5

There are no specific blogs for ARMC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC5
Entrez
Uniprot