We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

AP1S3 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: AP1S3 Antibody [NBP2-49493] - Staining of human cell line HaCaT shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AP1S3 Antibody [NBP2-49493] - Staining of human stomach shows moderate cytoplasmic positivity in subset of glandular cells.

Product Details

Summary
Product Discontinued
View other related AP1S3 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-49493
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AP1S3 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP1S3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AP1S3 Antibody - BSA Free

  • Adapter-Related Protein Complex 1 Subunit Sigma-1C
  • Adaptor Protein Complex AP-1 Sigma-1C Subunit
  • Adaptor Protein Complex AP-1 Subunit Sigma-1C
  • Adaptor-Related Protein Complex 1 Subunit Sigma-1C
  • Adaptor-Related Protein Complex 1, Sigma 3 Subunit
  • Clathrin Assembly Protein Complex 1 Sigma-1C Small Chain
  • Golgi Adaptor HA1/AP1 Adaptin Sigma-1C Subunit
  • PSORS15
  • Sigma 1C Subunit Of AP-1 Clathrin
  • Sigma1C-Adaptin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AP1S3 Antibody (NBP2-49493) (0)

There are no publications for AP1S3 Antibody (NBP2-49493).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP1S3 Antibody (NBP2-49493) (0)

There are no reviews for AP1S3 Antibody (NBP2-49493). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AP1S3 Antibody (NBP2-49493) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP1S3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1S3