ALG1L6P Antibody


Western Blot: ALG1L6P Antibody [NBP1-70606] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

ALG1L6P Antibody Summary

Synthetic peptides corresponding to LOC339879(hypothetical LOC339879) The peptide sequence was selected from the C terminal of LOC339879. Peptide sequence HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOC339879 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALG1L6P Antibody

  • asparagine-linked glycosylation 1-like 6, pseudogene
  • LOC339879 asparagine-linked glycosylation 1 homolog pseudogene


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALG1L6P Antibody (NBP1-70606) (0)

There are no publications for ALG1L6P Antibody (NBP1-70606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG1L6P Antibody (NBP1-70606) (0)

There are no reviews for ALG1L6P Antibody (NBP1-70606). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG1L6P Antibody (NBP1-70606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALG1L6P Antibody Products

ALG1L6P NBP1-70606

Bioinformatics Tool for ALG1L6P Antibody (NBP1-70606)

Discover related pathways, diseases and genes to ALG1L6P Antibody (NBP1-70606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ALG1L6P

There are no specific blogs for ALG1L6P, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol ALG1L6P

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-70606 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought