ALG1L6P Antibody

Images

 
Western Blot: ALG1L6P Antibody [NBP1-70606] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG1L6P Antibody Summary

Immunogen
Synthetic peptides corresponding to LOC339879(hypothetical LOC339879) The peptide sequence was selected from the C terminal of LOC339879. Peptide sequence HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG1L6P
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOC339879 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALG1L6P Antibody

  • asparagine-linked glycosylation 1-like 6, pseudogene
  • LOC339879 asparagine-linked glycosylation 1 homolog pseudogene

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALG1L6P Antibody (NBP1-70606) (0)

There are no publications for ALG1L6P Antibody (NBP1-70606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG1L6P Antibody (NBP1-70606) (0)

There are no reviews for ALG1L6P Antibody (NBP1-70606). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG1L6P Antibody (NBP1-70606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG1L6P Products

ALG1L6P NBP1-70606

Bioinformatics Tool for ALG1L6P Antibody (NBP1-70606)

Discover related pathways, diseases and genes to ALG1L6P Antibody (NBP1-70606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ALG1L6P

There are no specific blogs for ALG1L6P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG1L6P Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG1L6P