| Immunogen | In vivo generated recominant protein fragment |
| Epitope | RTLKHGEVALPVCSFCKEDQKADDEPLKECSECKAKYHIRKCLRYKEEFATNILKLNKWFCPRCVECDSCKGYIGDPSNIECTFCCRAWH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This product is useful for ELISA and for Immunofluorescence. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for mys-4 Antibody (48730002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.