We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human AIF-1/Iba1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related AIF-1/Iba1 Peptides and Proteins

Order Details


    • Catalog Number
      H00000199-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human AIF-1/Iba1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-147 of Human AIF1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP

Protein/Peptide Type
Recombinant Protein
Gene
AIF1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIF-1/Iba1 Protein

  • AIF1
  • AIF-1
  • allograft inflammatory factor 1
  • G1
  • IBA1
  • IbaI
  • interferon gamma responsive transcript
  • Ionized calcium-binding adapter molecule 1
  • IRT1
  • IRT-1
  • Protein G1

Background

Allograft inflammatory factor (AIF-1) or ionized calcium-binding adapter molecule 1 (Iba1) is a cytosolic actin binding protein containing a calcium binding domain (EF-hand) and inducible by cytokines and IFN-gamma (1). AIF-1 (theoretical molecular weight 17kDa) was first cloned from rat and human cardiac allografts and macrophage cell lines. In cardiac allografts, expression of AIF-1 was specifically associated with infiltrated mononuclear cells (2, 3). AIF-1 is constitutively expressed and inducible in macrophages and microglia. Iba1, microglia response factor (MRF-1) and daintain were independently cloned and identified in rat and human tissues and share complete sequence identity with AIF-1. Additionally, several AIF-1 splice variants have been identified including IRT-1, BART-1, G1 and Hara-1 (2).

Several cellular functions have been associated with AIF-1/Iba1 expression including cell growth, cell migration, actin bundling, membrane ruffling, and phagocytic activity (2, 4). Iba1 induces Rac signaling through a PLC-gamma dependent pathway (1). Rac, a member of the Rho family of small GTPases, localizes with Iba1 and F-actin in membrane ruffles and phagocytic cups and plays a role in microglia activation. AIF-1/Iba1 induction in macrophages and microglia occur in association with immunological inflammatory processes in various disease states including endometriosis, cerebral infarction and rheumatoid arthritis (5). Immunodetection of Iba1 through flow cytometry, immunohistochemical or immunocytochemical applications is commonly used for identification and analysis of microglia.

References

1. Imai, Y., & Kohsaka, S. (2002). Intracellular signaling in M-CSF-induced microglia activation: Role of Iba1. GLIA. https://doi.org/10.1002/glia.10149

2. Deininger, M. H., Meyermann, R., & Schluesener, H. J. (2002). The allograft inflammatory factor-1 family of proteins. FEBS Letters. https://doi.org/10.1016/S0014-5793(02)02430-4

3. Utans, U., Quist, W. C., Mcmanus, B. M., Wilson, J. E., Arceci, R. J., Wallace, A. F., & Russell, M. E. (1996). Allograft inflammatory factor-1: A cytokine-responsive macrophage molecule expressed in transplanted human hearts. Transplantation. https://doi.org/10.1097/00007890-199605150-00018

4. Franco-Bocanegra, McAuley, Nicoll, & Boche. (2019). Molecular Mechanisms of Microglial Motility: Changes in Ageing and Alzheimer's Disease. Cells. https://doi.org/10.3390/cells8060639

5. Kimura, M., Kawahito, Y., Obayashi, H., Ohta, M., Hara, H., Adachi, T., ... Yoshikawa, T. (2007). A Critical Role for Allograft Inflammatory Factor-1 in the Pathogenesis of Rheumatoid Arthritis. The Journal of Immunology. https://doi.org/10.4049/jimmunol.178.5.3316

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NB100-2688
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-683
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, EM, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for AIF-1/Iba1 Recombinant Protein (H00000199-P01) (0)

There are no publications for AIF-1/Iba1 Recombinant Protein (H00000199-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIF-1/Iba1 Recombinant Protein (H00000199-P01) (0)

There are no reviews for AIF-1/Iba1 Recombinant Protein (H00000199-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIF-1/Iba1 Recombinant Protein (H00000199-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AIF-1/Iba1 Products

Research Areas for AIF-1/Iba1 Recombinant Protein (H00000199-P01)

Find related products by research area.

Blogs on AIF-1/Iba1.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AIF-1/Iba1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIF1