PLTP Antibody (H00005360-A01)
PLTP Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
PLTP Antibody Summary: | | Gene: | PLTP |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PLTP - phospholipid transfer protein |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PLTP Products PLTP Antibody Details: | Immunogen: | PLTP (AAH05045, 19 a.a. ~ 442 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MALFGALFLALLAGAHAVFPGCKIRVTSKA LELVKQEGLRFLEQELETITIPDLRGKEGH FYYNISEVKVTELQLTSSELDFQPQQELML QITNASLGLRFRRQLLYWFFYDGGYINASA EGVSIRTGLELSRDPAGRMKVSNVSCQASV SRMHAAFGGTFKKVYDFLSTFITSGMRFLL NQQICPVLYHAGTVLLNSLLDTVPVRSSVD ELVGIDYSLMKDPVASTSNLDMDFRGAFFP LTERNWSLPNRAVEP |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to ELISA on the immunizing protein. |
|---|
| Dilutions: | ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene.
|
Reviews (0) Related Products (13) Exploring PLTP
|
Jump to: Ask a Question
|
Working with PLTP
PLTP Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about PLTP? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| PLTP Antibody | NB400-106 | Hu, Mu | IHC, IHC-P, WB | (1) | (4) | | | | PLTP Antibody (2F3-G4) | H00005360-M01 | Hu | ELISA, IHC-P, WB | (2) | (1) | | | | PLTP Antibody | NBP1-40173 | Hu, Mu | IHC-P, WB | (1) | | | | | PLTP Antibody | H00005360-D01P | Hu | ELISA, WB | (2) | | | | | PLTP Antibody | PAB8933 | Hu, Mu | IHC-P, WB | | | | | | ... and 3 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
