LDL Receptor Antibody (H00003949-A01)
LDL Receptor Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-FH antibody, anti-FHC antibody, |
|
|
LDL Receptor Antibody Summary: | | Gene: | LDLR |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | LDLR - low density lipoprotein receptor (familial hypercholesterolemia) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LDL Receptor Products LDL Receptor Antibody Details: | Immunogen: | LDLR (NP_000518, 105 a.a. ~ 206 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | PPKTCSQDEFRCHDGKCISRQFVCDSDRDC LDGSDEASCPVLTCGPASFQCNSSTCIPQL WACDNDPDCEDGSDEWPQRCRGLYVFQGDS SPCSAFEFHCL* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia.
|
Reviews (0) Related Products (31) Exploring LDL Receptor
|
Jump to: Ask a Question
|
Working with LDL Receptor
LDL Receptor Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LDL Receptor? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (24)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| LDL Receptor Antibody (C7) | NBP1-78159 | Bv, Hu | ICC, IF, IHC-P, IP, WB | (2) | (6) | | | | LDL Receptor Antibody | NBP1-06709 | Hu, Mk, Mu | WB | (1) | (3) | | | | LDL Receptor Antibody (EP1553Y) | NB110-57162 | Hu, Mu, Rt | FACS, ICC, IHC-P, IP, WB | (3) | (3) | | | | LDL Receptor Antibody | NBP1-87476 | Hu | IF, IHC-P, WB | (2) | | | | | LDL Receptor Antibody | NBP1-87579 | Hu | IF, IHC-P, WB | (1) | | | | | ... and 19 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| LDL Receptor in Context
Research Areas related to LDL Receptor (2): |
|
Novus Explorer for LDL Receptor gene
|
|
