Home » Histone H2AX » Histone H2AX Antibodies » Histone H2AX Antibody

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Histone H2AX Antibody

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Histone H2AX Primary Antibodies

Order Details


    • Catalog Number
      H00003014-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Histone H2AX Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
H2AFX (NP_002096.1, 1 a.a. - 143 a.a.) full-length human protein. MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H2AX
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Histone H2AX Antibody

  • H2A.X
  • H2A/X
  • H2AFX
  • Histone H2AX

Background

H2A.X is a member of the histone H2A family, 1 of 5 families of histone proteins involved in nucleosomal organization of chromatin. H2A.X is synthesised in G1 as well as S phase and is known to be important for recombination between immunoglobulin switch regions. A very early step in the response of mammalian cells to DNA double-strand breaks is the phosphorylation of histone H2A.X at serine 139 at the sites of DNA damage. There is a predicted acetylation at residue 1 and ubiquitination at reside 119. Phosphorylated H2A.X promotes DNA repair and maintains genomic stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATM Antibody (2C1)
- Azide and BSA Free
NB100-309
Western Blot ATM Antibody (2C1) - Azide and BSA Free
Western Blot ATM Antibody (2C1) - Azide and BSA Free
Immunoprecipitation ATM Antibody (2C1) - Azide and BSA Free
(3 Reviews)
(132 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
Chk2 Antibody
(OTI5C4) - Azide and ...
NBP2-71688
Western Blot Chk2 Antibody (OTI5C4) - Azide and BSA Free
CyTOF-ready Chk2 Antibody (OTI5C4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Chk2 Antibody (OTI5C4) - Azide and BSA Free
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
53BP1 Antibody -
BSA Free
NB100-304
Western Blot 53BP1 Antibody - BSA Free
Knockout Validated 53BP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 53BP1 Antibody - BSA Free
(14 Reviews)
(817 Publications)
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, COMET, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, mIF, Simple Western, WB
Chk1 Antibody -
BSA Free
NB100-464
Immunoprecipitation Chk1 Antibody - BSA Free
Immunohistochemistry-Paraffin Chk1 Antibody - BSA Free
Western Blot Chk1 Antibody - BSA Free
(13 Publications)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
ATR Antibody (2B5)
- Azide and BSA Free
NB100-308
Western Blot ATR Antibody (2B5) - Azide and BSA Free
Western Blot ATR Antibody (2B5) - Azide and BSA Free
Western Blot ATR Antibody (2B5) - Azide and BSA Free
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
Western Blot p21/CIP1/CDKN1A Antibody (WA-1)
Western Blot p21/CIP1/CDKN1A Antibody (WA-1)
(26 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry MMAB Antibody (OTI2G5)
Flow Cytometry MMAB Antibody (OTI2G5)
Western Blot MMAB Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
Nbs1 Antibody -
BSA Free
NB100-143
Western Blot Nbs1 Antibody - BSA Free
Western Blot Nbs1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Nbs1 Antibody - BSA Free
(8 Reviews)
(206 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
MDC1 Antibody -
BSA Free
NB100-395
Western Blot MDC1 Antibody - BSA Free
Western Blot MDC1 Antibody - BSA Free
Immunoprecipitation MDC1 Antibody - BSA Free
(2 Reviews)
(20 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
DDR1 Antibody
[Unconjugated]
AF2396
Western Blot DDR1 Antibody [Unconjugated]
Simple Western DDR1 Antibody [Unconjugated]
Immunohistochemistry DDR1 Antibody [Unconjugated]
(1 Review)
(12 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
BRCA1 Antibody
(6B4) - Azide and BSA ...
NB100-404
Western Blot BRCA1 Antibody (6B4) - Azide and BSA Free
Western Blot BRCA1 Antibody (6B4) - Azide and BSA Free
Western Blot BRCA1 Antibody (6B4) - Azide and BSA Free
(11 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
DNA-PKcs Antibody
NB100-658
Western Blot DNA-PKcs Antibody
Western Blot DNA-PKcs Antibody
Western Blot DNA-PKcs Antibody
(1 Review)
(3 Publications)
Species: Hu
Applications: IP, KD, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC,  IHC-P, WB
D4S234E Antibody
(1C3) - Azide and BSA ...
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
Western Blot D4S234E Antibody (1C3) - Azide and BSA Free
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(438 Publications)
Species: Hu, Mu
Applications: ICC, IHC

Publications for Histone H2AX Antibody (H00003014-D01P) (0)

There are no publications for Histone H2AX Antibody (H00003014-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H2AX Antibody (H00003014-D01P) (0)

There are no reviews for Histone H2AX Antibody (H00003014-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Histone H2AX Antibody (H00003014-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H2AX Products

Research Areas for Histone H2AX Antibody (H00003014-D01P)

Find related products by research area.

Blogs on Histone H2AX

There are no specific blogs for Histone H2AX, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H2AX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol H2AX
Uniprot