Recombinant Human CDC25A Protein

Name: Recombinant Human CDC25A Protein
Brand: Novus Biologicals
SKU: H00000993-Q01
Price: 449 USD
Availability: Discontinued

Submit a Review

Images

Product Details

Summary

Product Discontinued

Order Details

Catalog Number

H00000993-Q01
Availability

Product Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

Recombinant Human CDC25A Protein Summary

Description	A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human CDC25A partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT
Details of Functionality	This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type	Partial Recombinant Protein
Gene	CDC25A

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Application Notes	Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC25A Protein

CDC25A
CDC25A2
CDC25A2-CAG isoform
cell division cycle 25 homolog A (S. cerevisiae)
cell division cycle 25 homolog A (S. pombe)
cell division cycle 25A
Dual specificity phosphatase Cdc25A
EC 3.1.3.48
M-phase inducer phosphatase 1

Background

CDC25A - cell division cycle 25A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDK2 Antibody
[Unconjugated]

AF4654

Western Blot CDK2 Antibody [Unconjugated]

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC, IHC, Simple Western, WB

Chk1 Antibody -
BSA Free

NB100-464

Immunohistochemistry-Paraffin Chk1 Antibody - BSA Free

(13 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

CDC25C Antibody
(461908) [Unconjugate

MAB4459

(2 Publications)

Species: Hu, Mu, Rt

Applications: WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(26 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Chk2 Antibody
(OTI5C4) - Azide and ...

NBP2-71688

CyTOF-ready Chk2 Antibody (OTI5C4) - Azide and BSA Free

Western Blot Chk2 Antibody (OTI5C4) - Azide and BSA Free

Species: Ca, Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB

RASGRF1 Antibody -
BSA Free

NBP1-85727

Immunohistochemistry-Paraffin RASGRF1 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P

CDC25B Antibody
[Unconjugated]

AF1649

Western Blot CDC25B Antibody [Unconjugated]

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

(3 Reviews)

(45 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

CDC2/CDK1 Antibody
- BSA Free

NBP1-85729

Immunocytochemistry/ Immunofluorescence CDC2/CDK1 Antibody - BSA Free

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

Simple Western c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(48 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

TCEAL1 Antibody
(OTI2G10)

NBP2-46085

Species: Hu

Applications: IHC, IHC-P, WB

D4S234E Antibody
(1C3) - Azide and BSA ...

H00027065-M01

(1 Publication)

Species: Hu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

CDK4 Antibody -
BSA Free

NBP1-31308

Immunohistochemistry-Paraffin CDK4 Antibody - BSA Free

(7 Publications)

Species: Bv, Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Cyclin D1 Antibody
(SPM587)

NBP2-32840

Western Blot Cyclin D1 Antibody (SPM587)

(1 Review)

(9 Publications)

Species: Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

ATM Antibody (2C1)
- Azide and BSA Free

NB100-309

(3 Reviews)

(132 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

p27/Kip1 [p
Thr157] Antibody

AF1555

(1 Review)

(17 Publications)

Species: Hu

Applications: WB

RB1 Antibody
(607121) [Unconjugate

MAB6495

Simple Western RB1 Antibody (607121) [Unconjugated]

(8 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

26S proteasome
subunit 9 Antibody - ...

NBP2-47561

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

TMED7 Antibody -
BSA Free

NBP1-90949

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Recombinant Human
CDC25A Protein

H00000993-Q01

Species: Hu

Applications: WB, ELISA, MA, AP

Publications for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

There are no publications for CDC25A Partial Recombinant Protein (H00000993-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

There are no reviews for CDC25A Partial Recombinant Protein (H00000993-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC25A Products

Research Areas for CDC25A Partial Recombinant Protein (H00000993-Q01)

Find related products by research area.

Blogs on CDC25A

There are no specific blogs for CDC25A, but you can read our latest blog posts.

Contact Information

Product PDFs

PDF Datasheet

Request CofA

Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human CDC25A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

CDC25A

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human CDC25A Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human CDC25A Protein Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human CDC25A Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

Reviews for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

Product General Protocols

Video Protocols

FAQs for CDC25A Partial Recombinant Protein (H00000993-Q01) (0)

Additional CDC25A Products

Research Areas for CDC25A Partial Recombinant Protein (H00000993-Q01)

Blogs on CDC25A

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics