AKT1 Antibody (H00000207-M04)

AKT1 Antibody (6D6)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
AKT1 Antibody (6D6) Summary:
Species:Hu
Applications:ELISA, IHC-P, WB
Clonality:Monoclonal
Gene:AKT1
Purity:IgG purified
Host:Mouse
Specificity:AKT1 - v-akt murine thymoma viral oncogene homolog
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional AKT1 Products
AKT1 Antibody (6D6) Details:
Clone:6D6
Isotype:IgG2a Kappa
Immunogen:AKT1 (AAH00479, 1 a.a. ~ 481 a.a) full length recombinant protein with GST tag.
Localization:H00000207-M04
Epitope:MSDVAIVKEGWLHKRGEYIKTWRPRYFLLK NDGTFIGYKERP QDVDQREAPLNNFSVA QCQLMKTERPRPNTFIIRCLQWTTVI ER TFHVETPEEREEWTTAIQTVADGLKKQEEE EMDFRSGSPS DNSGAEEMEVSLAKPKHR VTMNEFEYLKLLGKGTFGKVILVK EKAT GRYYAMKILKKEVIVAKDEVAHTLTENRVL QNSRHPFL TALKYSFQTHDRLCFVMEYA NGGELFFHLSRERVF
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Dilutions:ELISA, Immunohistochemistry-Paraffin, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Phosphate buffered saline, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: AKT1
Entrez207 (Human)
OMIM164730, 181500
Swiss ProtAAH00479 (Human)
 
Background:

The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene.

Jump to: Images, Ask a Question

Working with AKT1

AKT1 Antibody (6D6) Images (3)
Immunoperoxidase of monoclonal antibody to AKT1 ( Cat # H00000207-M04 ) on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]AKT1 monoclonal antibody (M04), clone 6D6 Western Blot analysis of AKT1 expression in HeLa ( Cat # L013V1 ).
Detection limit for recombinant GST tagged AKT1 is approximately 1ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about AKT1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 [p Thr308, p Thr309] Antibody PairDP0247HuPLA(1)

AKT1 [p Tyr315] Antibody PairDP0245HuPLA(1)

AKT1 [p Thr450] Antibody PairDP0246HuPLA(1)

AKT1 Antibody PairH00000207-AP11HuELISA(1)

AKT1 [p Ser124] Antibody PairDP0114HuPLA(4)

... and 1 more. See All »
Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 LysateNBL1-07441WB(1)

AKT1 LysateH00000207-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 ProteinP3835HuFunc, PAGE

AKT1 Partial Recombinant ProteinH00000207-Q02HuELISA, WB(1)

AKT1 Partial Recombinant ProteinH00000207-Q01HuELISA, WB(1)

AKT1 Recombinant ProteinH00000207-P01HuELISA, WB(1)

AKT1 ProteinP4185HuFunc, PAGE

Primary Antibodies (55)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 [p Ser473] AntibodyNB600-590HuELISA, ICC, IF, IHC-P, WB(6)(1)

AKT1 Antibody (2E11)H00000207-M03Hu, Mu, RtELISA, IF, IHC-P, WB(7)

AKT1 AntibodyNB600-467HuELISA, IF, IHC-P, WB(4)(1)

AKT1 Antibody (Y89)NB110-55448Hu, Mu, RtFACS, ICC, IHC-P, IP, WB(2)(1)

AKT1 Antibody (6F11)H00000207-M09HuELISA, IF, WB(6)

... and 50 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
AKT1 RNAiH00000207-R02VHu(2)(4)

AKT1 RNAiH00000207-R01VHu(2)(4)

AKT1 RNAiH00000207-R08Hu(1)(4)

AKT1 RNAiH00000207-R07Hu(1)(4)

AKT1 RNAiH00000207-R09Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

AKT1 in Context


Research Areas related to AKT1 (8):
Novus Explorer for AKT1 gene

Try our bioinformatic tool that shows the relationships between AKT1 and other genes, diseases, pathways and post-translational modifications.